PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 209aa    MW: 22623.6 Da    PI: 9.168
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019808genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.86.6e-42191181100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l++el+++k
  DCAR_019808  19 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLLEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQQQIQSLQVELSAVK 116
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_019808 117 DE 118
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.64318119IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4219116IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRRHMSLRH PGSLNTITPC AACKLLRRRC AQECPFSPYF SPHEPQKFAS VHKVFGASNV  60
SKLLLEVPEN QRADAANSLV YEANVRLRDP VYGCMGAISA LQQQIQSLQV ELSAVKDEIL  120
RYNKYYTATR KTTGVLPTHV GDFISSGAAV SVINTAPLPI PTSQSQLLQQ PTSAPTTTSS  180
SSNSMYTVTT STATNYSTLS TDNVSYFG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279029.17e-87PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLD7T4G08e-87D7T4G0_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g02380.t012e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-64LOB domain-containing protein 15